Description

  • Product name

    Recombinant Human Neuron navigator 1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKLTDIRLEALNSAHQLDQLRETMHNMQLEVDLLKAENDRLKVAPGPSSG STPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEE VTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKD YISKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVS LKGLKEKCVDSLVFETLIPKPMMQHYISLLLKHRRLVLSGPSGTGKTYLT NRLAEYLVERSGREVTEGIVSTFNMHQQSCKDLQLYLSNLANQIDRETGI GDVPLVILLDDLSEAGSISELVNGALTCKYHKCPYIIGTTNQPVKMTPNH GLHLSFRMLTFSNNVEPANGFLVRYLRRKLVESDSDINANKEELLRVLDW VPKLWYHLHTFLEKHSTSDFLIGPCFFLSCPIGIEDFRTWFIDLWNNSII PYLQEGAKDGIKVHGQKAAWEDPVEWVRDTLPWPSAQQDQSKLYHLPPPT VGPHSIASPPEDRTVKDSTPSSLDSDPLMAMLLKLQEAANYIESPDRETI LDPNLQATL
    • Predicted molecular weight

      89 kDa including tags
    • Amino acids

      1319 to 1877

Specifications

Our Abpromise guarantee covers the use of ab132318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp781D0314
    • FLJ12560
    • FLJ14203
    • KIAA1151
    • MGC14961
    • mNav1
    • mouse Nav1
    • Nav 1
    • Nav1
    • neuron navigator 1
    • POMFIL 3
    • POMFIL3
    • Pore membrane and/or filament interacting like protein 3
    • Protein Steerin 1
    • Protein Steerin1
    • Steerin 1
    • Steerin1
    • unc-53 homolog 1
    • UNC53H1
    see all
  • Relevance

    The development of the nervous system (NS) requires the coordinated migration of multiple waves of neurons and subsequent processes of neurite maturation, both involving selective guidance mechanisms. In Caenorhabditis elegans, unc-53 codes for a new multidomain protein involved in the directional migration of a subset of cells. We describe here the first functional characterization of the mouse homologue, mouse Neuron navigator 1 (mNAV1) expression is primarily restricted to the CNS during development. mNAV1 is a microtubules associated protein. The abolition of mNAV1 causes loss of directionality in the leading processes of pontine-migrating cells, providing evidence for a role of mNAV1 in mediating (Netrin1-induced) directional migration.
  • Cellular localization

    Cytoplasm › cytoskeleton. Note: Associates with a subset of microtubule plus ends. Enriched in neuronal growth cone.

Images

  • 12.5% SDS-PAGE analysis of ab132318 stained with Coomassie Blue.

References

ab132318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up