Overview

  • Product name
    Recombinant Human Neuronal calcium-binding protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK NDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFS EHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETV SQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRS VSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLRE EDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSA QKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTV FFPASWWIMNNN
    • Amino acids
      1 to 362
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • amyloid beta (A4) precursor protein binding, family A, member 2 binding protein
    • Amyloid beta A4 protein binding family A member 2 binding protein
    • Amyloid beta A4 protein-binding family A member 2-binding protein
    • APBA2BP
    • dJ63M2.4
    • dJ63M2.5
    • EFCBP3
    • N terminal EF hand calcium binding protein 3
    • N-terminal EF-hand calcium-binding protein 3
    • NECA3_HUMAN
    • NECAB3
    • Nek2 interacting protein 1
    • Nek2-interacting protein 1
    • Neuronal calcium binding protein 3
    • Neuronal calcium-binding protein 3
    • NIP1
    • STIP3
    • Synaptotagmin interacting protein 2
    • SYTIP2
    • X11L binding protein 51
    • X11L-binding protein 51
    • XB51
    see all
  • Function
    Inhibits the interaction of APBA2 with beta-amyloid precursor protein (APP), and hence allows formation of beta-amyloid.
  • Tissue specificity
    Strongly expressed in heart and skeletal muscle, moderately in brain and pancreas.
  • Sequence similarities
    Contains 1 ABM domain.
    Contains 1 EF-hand domain.
  • Post-translational
    modifications
    Phosphorylated by NEK2.
  • Cellular localization
    Golgi apparatus.
  • Information by UniProt

Images

  • ab163759 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up