Description

  • Product name

    Recombinant Human Neuronatin protein
    See all Neuronatin proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQV LGERRQRAPN
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      22 to 81

Specifications

Our Abpromise guarantee covers the use of ab152574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Neuronatin
    • NNAT
    • NNAT_HUMAN
    • Peg 5
    • Peg5
    see all
  • Function

    May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
  • Sequence similarities

    Belongs to the neuronatin family.
  • Developmental stage

    Abundant in 18-24 week old fetal brain. Postnatally its expression decline and only minimal levels were present in adulthood.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152574 stained with Coomassie Blue.

References

ab152574 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up