Description

  • Product name

    Recombinant human Neuropilin 1 protein
    See all Neuropilin 1 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized soluble Neuropilin 1 binds all VEGF-A isoforms with the exception of VEGF.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINF NP HFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFL FIKFVS DYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKY PNSLECTYIV FAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWD GFPDVGPHIGRYCG QKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYS VLQSSVSEDFKCMEALGM ESGEIHSDQITASSQYSTNWSAERSRLNYP ENGWTPGEDSYREWIQVDLGLL RFVTAVGTQGAISKETKKKYYVKTYK IDVSSNGEDWITIKEGNKPVLFQGNT NPTDVVVAVFPKPLITRFVRIK PATWETGISMRFEVYGCKITDYPCSGMLGM VSGLISDSQITSSNQGDR NWMPENIRLVTSRSGWALPPAPHSYINEWLQIDL GEEKIVRGIIIQGG KHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFE GNNNYDTPEL RTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPT TPNGNL VDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSGIKL EH HHHHH
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      22 to 641
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water or PBS at a concentration of not lower than 100 µg/ml.

General Info

  • Alternative names

    • A5 protein
    • BDCA4
    • BLOOD DENDRITIC CELL ANTIGEN 4
    • CD304
    • Neuropilin-1
    • Neuropilin1
    • NP1
    • NPN1
    • NRP
    • NRP 1
    • NRP1
    • NRP1_HUMAN
    • transmembrane receptor
    • Vascular endothelial cell growth factor 165 receptor
    • VEGF165R
    see all
  • Function

    The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF-165 isoform of VEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis.
    The soluble isoform 2 binds VEGF-165 and appears to inhibit its binding to cells. It may also induce apoptosis by sequestering VEGF-165. May bind as well various members of the semaphorin family. Its expression has an averse effect on blood vessel number and integrity.
  • Tissue specificity

    The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and placenta; moderately in lung, liver, skeletal muscle, kidney and pancreas; and low in adult brain. Isoform 2 is found in liver hepatocytes, kidney distal and proximal tubules.
  • Sequence similarities

    Belongs to the neuropilin family.
    Contains 2 CUB domains.
    Contains 2 F5/8 type C domains.
    Contains 1 MAM domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Functional ELISA showing binding of VEGF-A isoforms to ab204616 at 1µg/ml (100µl/well), the ligands were added with 10ng/ml.

  • SDS PAGE analysis of ab204616 on 10% SDS PAGE gel under reducing conditions stained with Coomassie blue.

References

ab204616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up