Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMSDSEEEMKALEADFLTNMHTSKISK AHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSL EAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYIL KRQLYENKPRRPYILKRDSYYY
    • Molecular weight

      20 kDa including tags
    • Amino acids

      24 to 170
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Human proneurotensin
    • Large neuromedin N
    • Neuromedin N preproprotein
    • Neurotensin/neuromedin N
    • NEUT_HUMAN
    • NmN
    • NMN 125
    • NmN-125
    • NN
    • NT
    • NT/N
    • NTRH
    • NTS
    • NTS1
    • Pro neurotensin/neuromedin
    • Proneuromedin N mRNA
    • Tail peptide
    see all
  • Function

    Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
  • Sequence similarities

    Belongs to the neurotensin family.
  • Cellular localization

    Secreted. Cytoplasmic vesicle > secretory vesicle. Packaged within secretory vesicles.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139239.

References

ab139239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up