Recombinant Human Neurotrypsin protein (ab160050)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCR HSEDAGVICDYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRG
    • Amino acids
      541 to 640
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BSSP 3
    • BSSP3
    • Leydin
    • MGC12722
    • Motopsin
    • MRT1
    • NETR_HUMAN
    • Neurotrypsin
    • protease, serine, 12 (neurotrypsin, motopsin)
    • Prss12
    • Serine protease 12
    see all
  • Function
    Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.
  • Tissue specificity
    Brain and Leydig cells of the testis.
  • Involvement in disease
    Defects in PRSS12 are the cause of mental retardation autosomal recessive type 1 (MRT1) [MIM:249500]. Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
    Contains 4 SRCR domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab160050 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up