Description

  • Product name

    Recombinant Human Neurotrypsin protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKR YGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALV RLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRT LQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLM CERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      631 to 874
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Peptidase S1 domain. N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab236162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • BSSP 3
    • BSSP3
    • Leydin
    • MGC12722
    • Motopsin
    • MRT1
    • NETR_HUMAN
    • Neurotrypsin
    • protease, serine, 12 (neurotrypsin, motopsin)
    • Prss12
    • Serine protease 12
    see all
  • Function

    Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.
  • Tissue specificity

    Brain and Leydig cells of the testis.
  • Involvement in disease

    Defects in PRSS12 are the cause of mental retardation autosomal recessive type 1 (MRT1) [MIM:249500]. Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
    Contains 4 SRCR domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab236162.

References

ab236162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up