Overview

  • Product name

    Recombinant Human NFE2L1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      DTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLR DENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRR
    • Molecular weight

      36 kDa including tags
    • Amino acids

      677 to 771

Specifications

Our Abpromise guarantee covers the use of ab152570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as Nuclear Factor Erythroid 2 Related Factor 1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • erythroid derived 2
    • like 1
    • Locus control region factor 1
    • Locus control region-factor 1
    • NF-E2-related factor 1
    • NF2L1_HUMAN
    • NFE2 related factor 1
    • NFE2-related factor 1
    • NFE2L1
    • NRF1
    • Nuclear factor
    • Nuclear Factor Erythroid 2 Related Factor 1
    • Nuclear factor erythroid 2-related factor 1
    • Nuclear factor erythroid derived 2 like 1
    • TCF-11
    • TCF11
    • Transcription factor 11
    • Transcription factor HBZ17
    • Transcription factor LCR F1
    • Transcription factor LCR-F1
    see all
  • Function

    Activates erythroid-specific, globin gene expression.
  • Sequence similarities

    Belongs to the bZIP family. CNC subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152570 stained with Coomassie Blue.

References

ab152570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up