Description

  • Product name

    Recombinant Human NFX1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKSHSFPPMNRDH RRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVCPPTTLTGVLEREM
    • Amino acids

      981 to 1080
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC20369
    • NFX 1
    • NFX1
    • NFX2
    • Nuclear transcription factor X box binding 1
    • Nuclear transcription factor X box binding protein 1
    • Transcriptional repressor NF X1
    see all
  • Relevance

    NFX1 is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. It may play a role in the inflammatory response, regulating its duration by limiting the period in which class II MHC molecules are induced by IFN gamma. The RING type zinc finger domain interacts with an ubiquitin conjugating enzyme (E2) and facilitates ubiquitination.
  • Cellular localization

    Nuclear

Images

  • ab158994 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up