Description

  • Product name

    Recombinant Human NGF protein
    See all NGF proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab55441 is purified by chromatographic techniques. Purity tested by SDS-PAGE and RP-HPLC.
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQT RNITVDPRLFKKRRLRSPRVL FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDS VSVWVGDKTTATDIKGKEVM VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFV KALTMDGKQAAWRFIRIDTA CVCVLSRKAVR.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab55441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab55441 can be dessicated and frozen at -18 centigrade for long term storage. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    pH: 7.20
    Constituents: 0.82% Sodium phosphate, 0.87% Sodium chloride

General Info

  • Alternative names

    • Beta nerve growth factor
    • Beta NGF
    • Beta-nerve growth factor
    • Beta-NGF
    • HSAN5
    • MGC161426
    • MGC161428
    • Nerve growth factor
    • Nerve growth factor (beta polypeptide)
    • Nerve growth factor beta
    • Nerve growth factor beta polypeptide
    • Nerve growth factor beta subunit
    • NGF
    • NGF_HUMAN
    • NGFB
    • NID67
    see all
  • Function

    Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177).
  • Involvement in disease

    Neuropathy, hereditary sensory and autonomic, 5
  • Sequence similarities

    Belongs to the NGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab55441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab55441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up