Recombinant human NGF protein (Animal Free) (ab179616)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human NGF protein (Animal Free)
See all NGF proteins and peptides -
Biological activity
The activity is determined by the ability to stimulate proliferation of TF-1 cells and is typically less than 1 ng/mL.
-
Purity
> 97 % SDS-PAGE.
assessed by HPLC, Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm. Note: This product is produced with no animal-derived raw products, animal free equipment and animal free protocols. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFK QYFFETKCRD PNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAA WRFIRIDTACVCVLSRKAVRRA -
Predicted molecular weight
14 kDa -
Amino acids
122 to 241 -
Additional sequence information
Mature form.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab179616 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. Reconstituted material should be aliquoted and frozen at -20°C
General Info
-
Alternative names
- Beta nerve growth factor
- Beta NGF
- Beta-nerve growth factor
see all -
Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177). -
Involvement in disease
Neuropathy, hereditary sensory and autonomic, 5 -
Sequence similarities
Belongs to the NGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab179616 has been referenced in 4 publications.
- Lebedev TD et al. The Different Impact of ERK Inhibition on Neuroblastoma, Astrocytoma, and Rhabdomyosarcoma Cell Differentiation. Acta Naturae 13:69-77 (2021). PubMed: 35127149
- Lucido CT et al. Innervation of cervical carcinoma is mediated by cancer-derived exosomes. Gynecol Oncol N/A:N/A (2019). PubMed: 31003747
- Lebedev TD et al. Two Receptors, Two Isoforms, Two Cancers: Comprehensive Analysis of KIT and TrkA Expression in Neuroblastoma and Acute Myeloid Leukemia. Front Oncol 9:1046 (2019). PubMed: 31681584
- Madeo M et al. Cancer exosomes induce tumor innervation. Nat Commun 9:4284 (2018). PubMed: 30327461