Overview

  • Product name

    Recombinant Human NgR3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      CPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHF SPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGL VKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVN LSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLT TLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFR GSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRA ARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQA PELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAVDHHH HHH
    • Molecular weight

      46 kDa including tags
    • Amino acids

      25 to 419
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as RTN4RL1.  

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 94% Phosphate Buffer, 5% Trehalose, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • DKFZp547J144
    • NgR 3
    • NgR3
    • NGRH 2
    • NGRH2
    • NGRL2
    • Nogo 66 receptor homolog 2
    • Nogo 66 receptor related protein 3
    • Nogo receptor like 2
    • Nogo receptor-like 2
    • Nogo-66 receptor homolog 2
    • Nogo-66 receptor-related protein 3
    • R4RL1_HUMAN
    • Reticulon 4 receptor like 1
    • Reticulon-4 receptor-like 1
    • RTN4RL1
    see all
  • Function

    May play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
  • Tissue specificity

    Predominantly expressed in brain. Expressed at lower levels in kidney, lung, mammary gland, placenta, salivary gland, skeletal muscle and spleen.
  • Sequence similarities

    Belongs to the Nogo receptor family.
    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Cellular localization

    Cell membrane. Localized to the surface of neurons, including axons.
  • Information by UniProt

References

ab152062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up