Overview

  • Product name

    Recombinant Human NGX6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFL LSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRT FLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGF QLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCIL SLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHF CKTHWSK
    • Amino acids

      1 to 257
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as C9orf127. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C9orf127
    • chromosome 9 open reading frame 127
    • MGC120460
    • NAG 5
    • Nasopharyngeal carcinoma expressed 6
    • Nasopharyngeal carcinoma related protein
    • Nasopharyngeal carcinoma-associated gene 6 protein
    • NGX6
    • Protein NAG-5
    • Protein NGX6
    • RP11-112J3.10
    • RP11-112J3.10-001
    • TMEM8B
    • TMM8B_HUMAN
    • Transmembrane protein 8B
    see all
  • Function

    May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion.
  • Sequence similarities

    Belongs to the TMEM8 family.
    Contains 1 EGF-like domain.
  • Post-translational
    modifications

    Isoform 2 is N-glycosylated.
  • Cellular localization

    Cell membrane. Cytoplasm. Nucleus. Mitochondrion. Endoplasmic reticulum. Also detected in mitochondrion and endoplasmic reticulum.
  • Information by UniProt

Images

  • ab162658 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up