Description

  • Product name

    Recombinant Human NHLH1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEP GEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRK LLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 133

Specifications

Our Abpromise guarantee covers the use of ab117028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names

    • bHLHa35
    • Class A basic helix-loop-helix protein 35
    • Helix-loop-helix protein 1
    • HEN-1
    • HEN1
    • HEN1_HUMAN
    • Nescient helix loop helix 1
    • Nhlh1
    • NSCL
    • NSCL-1
    • NSCL1
    • OTTHUMP00000031860
    see all
  • Function

    May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117028 at approximately 40.74 kDa.
    Stained with Coomassie Blue.

References

ab117028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up