Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIM ETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDF QVDDKTKALL
    • Amino acids
      32 to 141
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACHA3_HUMAN
    • AChR
    • Cholinergic receptor neuronal nicotinic alpha polypeptide 3
    • Cholinergic receptor nicotinic alpha 3
    • Cholinergic receptor nicotinic alpha polypeptide 3
    • CHRNA 3
    • CHRNA3
    • LNCR2
    • MGC104879
    • NACHRA 3
    • NACHRA3
    • Neuronal acetylcholine receptor protein alpha 3 chain precursor
    • Neuronal acetylcholine receptor subunit alpha 3
    • Neuronal acetylcholine receptor subunit alpha-3
    • Neuronal nicotinic acetylcholine receptor alpha 3 subunit
    • PAOD2
    see all
  • Function
    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-3/CHRNA3 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • ab158116 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up