Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIM ETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDF QVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWS YDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDI TYSLYIRRL
    • Molecular weight

      45 kDa including tags
    • Amino acids

      32 to 240
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain. N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab235815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Nicotinic Acetylcholine Receptor alpha 3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ACHA3_HUMAN
    • AChR
    • Cholinergic receptor neuronal nicotinic alpha polypeptide 3
    • Cholinergic receptor nicotinic alpha 3
    • Cholinergic receptor nicotinic alpha polypeptide 3
    • CHRNA 3
    • CHRNA3
    • LNCR2
    • MGC104879
    • NACHRA 3
    • NACHRA3
    • Neuronal acetylcholine receptor protein alpha 3 chain precursor
    • Neuronal acetylcholine receptor subunit alpha 3
    • Neuronal acetylcholine receptor subunit alpha-3
    • Neuronal nicotinic acetylcholine receptor alpha 3 subunit
    • PAOD2
    see all
  • Function

    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-3/CHRNA3 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235815.

References

ab235815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up