Description

  • Product name

    Recombinant Human Nicotinic Acetylcholine Receptor beta 2/CHRNB2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQ IMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADG MYEVS
    • Amino acids

      26 to 130
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Nicotinic Acetylcholine Receptor beta 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acetylcholine receptor beta 2 neural
    • ACHB2_HUMAN
    • ACHN
    • AChR
    • Acrb 2
    • Acrb2
    • b2 nAchR
    • Cholinergic receptor nicotinic beta 2
    • Cholinergic receptor nicotinic beta polypeptide 2
    • Cholinergic receptor nicotinic beta polypeptide 2 neuronal
    • cholinergic receptor, nicotinic, beta 2 (neuronal)
    • Chrnb2
    • EFNL 3
    • EFNL3
    • nAChRB2
    • Neuronal acetylcholine receptor protein beta 2 chain precursor
    • Neuronal acetylcholine receptor protein subunit beta 2
    • Neuronal acetylcholine receptor subunit beta-2
    • Neuronal nicotinic acetylcholine receptor beta 2
    see all
  • Function

    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Involvement in disease

    Defects in CHRNB2 are the cause of nocturnal frontal lobe epilepsy type 3 (ENFL3) [MIM:605375]. ENFL3 is an autosomal dominant epilepsy characterized by nocturnal seizures with hyperkinetic automatisms and poorly organized stereotyped movements.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Beta-2/CHRNB2 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • ab152280 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up