Overview

  • Product name

    Recombinant Human Nicotinic Acetylcholine Receptor epsilon/CHRNE protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETL TTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF GVAYDANVLV
    • Molecular weight

      38 kDa including tags
    • Amino acids

      21 to 130

Specifications

Our Abpromise guarantee covers the use of ab114817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Nicotinic Acetylcholine Receptor epsilon

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acetylcholine receptor subunit epsilon
    • ACHE_HUMAN
    • AChR
    • AchR epsilon subunit
    • ACHRE
    • Cholinergic receptor, nicotinic, epsilon polypeptide
    • Chrne
    • CMS1D
    • CMS1E
    • CMS2A
    • FCCMS
    • SCCMS
    see all
  • Function

    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Involvement in disease

    The muscle AChR is the major target antigen in the autoimmune disease myasthenia gravis. Myasthenia gravis is characterized by sporadic muscular fatigability and weakness, occurring chiefly in muscles innervated by cranial nerves, and characteristically improved by cholinesterase-inhibiting drugs.
    Myasthenic syndrome, congenital, 4A, slow-channel
    Myasthenic syndrome, congenital, 4B, fast-channel
    Myasthenic syndrome, congenital, 4C, associated with acetylcholine receptor deficiency
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Epsilon/CHRNE sub-subfamily.
  • Cellular localization

    Cell junction, synapse, postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up