Overview

  • Product name
    Recombinant Human NIFK protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVR HLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAK IVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYN RNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTN RQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVA ELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
    • Amino acids
      1 to 293
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hNIFK
    • MK67I_HUMAN
    • MKI67 FHA Domain Interacting Nucleolar Phosphoprotein
    • MKI67 FHA domain-interacting nucleolar phosphoprotein
    • mki67ip
    • NOPP34
    • Nucleolar phosphoprotein Nopp34
    • Nucleolar protein interacting with the FHA domain of pKI 67
    • Nucleolar protein interacting with the FHA domain of pKI-67
    • pKi67
    see all
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Sequentially phosphorylated on Thr-238, Thr-234 and Ser-230. Thr-234 is phosphorylated only when Thr-238 is phosphorylated. Likewise, phosphorylation at Ser-230 requires that Thr-234 and Thr-238 are phosphorylated. Phosphorylation enhances MKI67 binding.
  • Cellular localization
    Nucleus > nucleolus. Chromosome. Localizes to mitotic chromosomes in conjunction with MKI67.
  • Information by UniProt

Images

  • ab164582 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up