Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      YELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHL WAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
    • Amino acids

      185 to 284
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • NIPSNAP 1
    • Nipsnap homolog 1 (C. elegans)
    • Protein NipSnap homolog 1
  • Relevance

    NIPSNAP is a member of an evolutionarily well conserved gene family and has a strong sequence similarity to the central portion of a protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. Recent studies have indicated that NIPSNAP is involved in the regulation of the Ca2+-selective transient receptor potential vanilloid channel 6 (TRPV6). NIPSNAP1 associates with TRPV6 at the plasma membrane and inhibits TRPV6 currents. Other studies show that NIPSNAP’s expression is reduced in the phenylketonuria (PKU) mouse brain, suggesting that NIPSNAP may play a role in memory.
  • Cellular localization

    Mitochondrial

Images

  • ab160064 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up