Description

  • Product name

    Recombinant Human NIT2 protein
  • Purity

    > 95 % SDS-PAGE.
    ab102690 is purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTSFRLALIQLQISSIKSDNVTRACSF IREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLSEVAKECS IYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQ ESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPG AFNLTTGPAHWELLQRSRAVDNQVYVATASPARDDKASYVAWGHSTVVNP WGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      1 to 276
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • CUA002
    • MGC111199
    • NIT 2
    • Nit protein 2
    • NIT2
    • NIT2_HUMAN
    • Nitrilase family member 2
    • Nitrilase homolog 2
    • Omega amidase NIT2
    • Omega-amidase NIT2
    see all
  • Function

    Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.
  • Tissue specificity

    Detected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon.
  • Sequence similarities

    Belongs to the UPF0012 family.
    Contains 1 CN hydrolase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102690 (3 µg).

References

ab102690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up