Description

  • Product name

    Recombinant Human NK-p44 protein (denatured)
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSQAQSKAQVLQSVAGQTLTVRCQYPPTGS LYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMT DLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      19 to 130
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_004819.2

Specifications

Our Abpromise guarantee covers the use of ab177598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as NCR2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • Activating NK receptor NKp44
    • CD336
    • CD336 antigen
    • dJ149M18.1
    • LY95
    • Lymphocyte antigen 95 (activating NK receptor; NK p44)
    • Lymphocyte antigen 95 homolog
    • Lymphocyte antigen 95 homolog (activating NK receptor; NK p44)
    • Lymphocyte antigen 95, mouse, homolog of
    • Natural cytotoxicity triggering receptor 2
    • Natural killer cell p44 related protein
    • Natural killer cell p44-related protein
    • NCR2
    • NCTR2_HUMAN
    • NK cell activating receptor
    • NK cell activating receptor (NKp44)
    • NK cell-activating receptor
    • NK p44
    • NK-p44
    • NKp44
    see all
  • Function

    Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
  • Tissue specificity

    Selectively expressed by activated NK cells and by in vitro cultured (i.e. activated) TCRg/d lymphoid cells.
  • Sequence similarities

    Belongs to the natural cytotoxicity receptor (NCR) family.
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab177598.

References

ab177598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up