Overview

  • Product name
    Recombinant Human NKD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELP NGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPR GPGGQRLNIDALQCDVSVEEDDRQEWTFTLYDFDNCGKVTREDMSSLMHT IYEVVDASVNHSSGSSKTLRVKLTVSPEPSSKRKEGPPAGQDREPTRCRM EGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDENTERRNHYLDL AGIENYTSRFGPGSQLCEKRSSAPRTHSGDKARGVGLCRELWSQAGHPQW PGPFPSGLVAV
    • Amino acids
      1 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hNkd2
    • Naked 2
    • Naked-2
    • nkd2
    • NKD2_HUMAN
    • Protein naked cuticle homolog 2
    see all
  • Function
    Cell autonomous antagonist of the canonical Wnt signaling pathway. May activate a second Wnt signaling pathway that controls planar cell polarity (By similarity). Required for processing of TGFA and for targeting of TGFA to the basolateral membrane of polarized epithelial cells.
  • Tissue specificity
    Expressed in kidney, lung, pancreas and spleen.
  • Sequence similarities
    Belongs to the NKD family.
    Contains 1 EF-hand domain.
  • Developmental stage
    Expressed in fetal kidney and lung.
  • Domain
    The N-terminal domain comprising the first 217 amino acid residues is mostly unstructured.
  • Post-translational
    modifications
    Ubiquitinated, leading to rapid proteasomal degradation. Interaction with TGFA interferes with RNF25 binding and protects against ubiquitination mediated by RNF25.
  • Cellular localization
    Cell membrane. Cytoplasm. Cytoplasmic vesicle.
  • Information by UniProt

Images

  • ab164753 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up