Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQ DFQGNDKTYHCKDLPSAPEK
    • Amino acids
      1 to 70
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C lectin type II protein
    • CD159 antigen like family member A
    • CD159 antigen-like family member A
    • CD159a
    • CD159a antigen
    • Killer cell lectin like receptor subfamily C member 1
    • KLRC1
    • MGC13374
    • MGC59791
    • Natural killer cell lectin
    • Natural killer cell protein group 2-A1
    • Natural killer cell receptor NKG2A
    • Natural killer group protein 2
    • NK cell receptor A
    • NKG2
    • NKG2 1/B activating NK receptor
    • NKG2 A
    • NKG2 A/B activating NK receptor
    • NKG2 A/B type II integral membrane protein
    • NKG2 A/NKG2 B type II integral membrane protein
    • NKG2 B
    • NKG2-1/B activating NK receptor
    • NKG2-A/B-activating NK receptor
    • NKG2-A/NKG2-B type II integral membrane protein
    • NKG2A
    • NKG2A_HUMAN
    • NKG2B
    • rNKG2A
    see all
  • Function
    Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
  • Tissue specificity
    Natural killer cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158799 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up