Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      HHHHHHFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWY ESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDG SILSPNLLTIIEMQKGDCALYASSFKGYIE NCSTPNTYICMQRTV
    • Molecular weight

      17 kDa including tags
    • Amino acids

      78 to 216
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • CD314
    • CD314 antigen
    • D12S2489E
    • Killer cell lectin like receptor subfamily K member 1
    • Killer cell lectin-like receptor subfamily K member 1
    • KLR
    • KLRC4 KLRK1 readthrough
    • KLRK1
    • NK cell receptor D
    • NK lectin-like receptor
    • NKG2 D activating NK receptor
    • NKG2 D type II integral membrane protein
    • NKG2-D
    • NKG2-D type II integral membrane protein
    • NKG2-D-activating NK receptor
    • Nkg2d
    • NKG2D_HUMAN
    • NKLLR
    • NKR P2
    • Nkrp2
    see all
  • Function

    Receptor for MICA, MICB, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Involved in the immune surveillance exerted by T- and B-lymphocytes.
  • Tissue specificity

    Natural killer cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Also detected in gamma-delta cells and CD8+ alpha-beta T-cells. Expressed in interferon-producing killer dendritic cells (IKDCs).
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up