Overview

  • Product name

    Recombinant Human NKIRAS1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHT IGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFAD GFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQV DAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLP GRKNKGNSNSEN
    • Molecular weight

      24 kDa including tags
    • Amino acids

      1 to 192
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab123143 was purified using conventional chromatography.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol

General Info

  • Alternative names

    • 2400004O09Rik
    • I kappa B interacting Ras like protein 1
    • I-kappa-B-interacting Ras-like protein 1
    • Kappa B Ras 1
    • Kappa B Ras protein 1
    • Kappa B-Ras protein 1
    • KappaB Ras1
    • KappaB-Ras1
    • KBRAS 1
    • KBRAS1
    • KBRS1_HUMAN
    • NF kappa B inhibitor interacting Ras like protein 1
    • NF-kappa-B inhibitor-interacting Ras-like protein 1
    • NFKB inhibitor interacting Ras like 1
    • NFKB inhibitor interacting Ras like protein 1
    • NKIRAS 1
    • nkiras1
    see all
  • Function

    Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.
  • Domain

    In contrast to other members of the Ras family, the members of the KappaB-Ras subfamily do not contain the conserved Gly and Gln residues in positions 13 and 65, which are replaced by Leu residues, and are therefore similar to the constitutively active forms of oncogenic forms of Ras. This suggests that members of this family are clearly different from other small GTPases proteins.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12% SDS PAGE, 3 µg of ab123143 loaded.

References

ab123143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up