Recombinant human NKp30 protein (Fc Chimera Active) (ab184896)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: SDS-PAGE, ELISA
Description
-
Product name
Recombinant human NKp30 protein (Fc Chimera Active)
See all NKp30 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized Human B7-H6, His Tag at 10 μg/mL (100 μL/well) can bind ab184896 with a linear range of 2-78 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLA PLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLG VGTGNGTRLVVEKEHPQLG -
Predicted molecular weight
40 kDa including tags -
Amino acids
19 to 135 -
Tags
Fc tag C-Terminus -
Additional sequence information
Extracellular domain of NCR3 fused with Fc fragment of Human IgG1 at the C-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab184896 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
ELISA
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.
pH: 7.4
Constituents: 0.75% Glycine, 0.605% Tris, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- 1C7
- Activating natural killer receptor p30
- Activating NK A1 receptor
see all -
Function
Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation. -
Tissue specificity
Selectively expressed by all resting and activated NK cells and weakly expressed in spleen. -
Sequence similarities
Belongs to the natural cytotoxicity receptor (NCR) family.
Contains 1 Ig-like (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab184896 has not yet been referenced specifically in any publications.