Description

  • Product name

    Recombinant Human NKX2.8 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGH YPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELE RRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAES PDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGA PPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW
    • Amino acids

      1 to 239
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Homeobox protein NK 2 homolog H
    • Homeobox protein NK-2 homolog H
    • Homeobox protein Nkx 2.8
    • Homeobox protein Nkx-2.8
    • NK 2 homolog 8
    • NK 2 homolog H
    • NK2 homeobox 8
    • NK2 transcription factor related, locus 8
    • Nkx2 9
    • Nkx2-8
    • NKX2.8
    • NKX28_HUMAN
    • NKX2G
    • NKX2H
    • OTTHUMP00000027959
    see all
  • Sequence similarities

    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab161944 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up