Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFLRVPEPRPGEAKAEGAAPPTP SKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQ NDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQ PQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWF QNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPY LYCVGSWSPAFW
    • Molecular weight

      29 kDa including tags
    • Amino acids

      2 to 234
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134861 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-Arginine

General Info

  • Alternative names

    • BAPX 2
    • BAPX2
    • Homeobox protein NK-3 homolog A
    • Homeobox protein Nkx 3.1
    • Homeobox protein Nkx-3.1
    • Homeobox protein Nkx3.1
    • NK homeobox (Drosophila) family 3 A
    • NK homeobox family 3 A
    • NK homeobox, family 3, member A
    • NK3 homeobox 1
    • NK3 transcription factor homolog A
    • NK3 transcription factor related locus 1
    • NKX 3
    • Nkx 3.1
    • NKX 3A
    • NKX3
    • NKX3 1
    • Nkx3-1
    • NKX3.1
    • Nkx3.1, mouse, homolog of
    • NKX31_HUMAN
    • NKX3A
    see all
  • Function

    Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Play an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells.
  • Tissue specificity

    Highly expressed in the prostate and, at a lower level, in the testis.
  • Sequence similarities

    Belongs to the NK-3 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Ubiquitinated by TOPORS; monoubiquitinated at several residues and also polyubiquitinated on single residues.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up