Description

  • Product name

    Recombinant Human NLGN4X protein
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QAQYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPP EPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQD QNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILA SYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAF GGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNY QPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFG PVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVT PNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLV ALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGD EVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVP QDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWL ELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAI TPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      42 to 676
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab191619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from a 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • ASPGX2
    • AUTSX2
    • HLNX
    • HNL4X
    • HNLX
    • KIAA1260
    • neuroligin 4, X-linked
    • Neuroligin X
    • Neuroligin-4
    • NL4
    • NLGN
    • NLGN4
    • NLGN4X
    • NLGNX_HUMAN
    • OTTHUMP00000022863
    • OTTHUMP00000022864
    • OTTHUMP00000022865
    • X-linked
    see all
  • Function

    Putative neuronal cell surface protein involved in cell-cell-interactions.
  • Tissue specificity

    Expressed at highest levels in heart. Expressed at lower levels in liver, skeletal muscle and pancreas and at very low levels in brain.
  • Involvement in disease

    Defects in NLGN4X may be the cause of susceptibility to autism X-linked type 2 (AUTSX2) [MIM:300495]. AUTSX2 is a pervasive developmental disorder (PDD), prototypically characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age.
    Defects in NLGN4X may be the cause of susceptibility to X-linked Asperger syndrome 2 (ASPGX2) [MIM:300497]. ASPGX2 is considered to be a form of childhood autism.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab191619, stained overnight with Coomassie Blue. DTT-reduced NLGN4X migrates as 80-110 kDa due to glycosylation.

References

ab191619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up