Description

  • Product name

    Recombinant Human NM23A protein (His tag)
    See all NM23A proteins and peptides
  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH YVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKP GTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY E
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      2 to 152
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length protein without starter Methionine.

Specifications

Our Abpromise guarantee covers the use of ab221404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AWD
    • AWD, drosophila, homolog of
    • GAAD
    • Granzyme A activated DNase
    • Granzyme A-activated DNase
    • GZMA activated DNase
    • Metastasis inhibition factor NM23
    • NB
    • NBS
    • NDK A
    • NDKA
    • NDKA_HUMAN
    • NDP kinase A
    • NDPK-A
    • NDPKA
    • NM23
    • NM23 long variant, included
    • nm23-H1
    • NM23-M1
    • NM23H1B, included
    • NME/NM23 nucleoside diphosphate kinase 1
    • Nme1
    • NME1-NME2 spliced read-through transcript, included
    • Non-metastatic cells 1, protein (NM23A) expressed in
    • Nonmetastatic cells 1, protein expressed in
    • Nonmetastatic protein 23
    • Nonmetastatic protein 23, homolog 1
    • Nucleoside diphosphate kinase A
    • Tumor metastatic process-associated protein
    see all
  • Function

    Major role in the synthesis of nucleoside triphosphates other than ATP. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination.
  • Tissue specificity

    Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. Isoform 3 is ubiquitously expressed.
  • Sequence similarities

    Belongs to the NDK family.
  • Cellular localization

    Cytoplasm. Nucleus. Cell-cycle dependent nuclear localization which can be induced by interaction with Epstein-barr viral proteins or by degradation of the SET complex by GzmA.
  • Information by UniProt

Images

  • SDS-PAGE using ab221404. DTT-reduced protein migrates as 21 kDa.

References

ab221404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up