Description

  • Product name

    Recombinant Human NME3 protein
    See all NME3 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGF KLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDV VRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALW FRADELLCWEDSAGHWLYE
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 169

Specifications

Our Abpromise guarantee covers the use of ab132647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • c371H6.2
    • DR-nm23
    • Expressed in non metastatic cells 3
    • NDK 3
    • NDK3
    • NDK3_HUMAN
    • NDP kinase 3
    • NDP kinase C
    • NDPK C
    • NDPKC
    • NM23 H3
    • nm23-H3
    • NM23H3
    • NME 3
    • NME/NM23 nucleoside diphosphate kinase 3
    • Nme3
    • Non metastatic cells 3 protein expressed in
    • Nucleoside diphosphate kinase 3
    • Nucleoside diphosphate kinase C
    see all
  • Function

    Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.
  • Sequence similarities

    Belongs to the NDK family.
  • Developmental stage

    Preferentially expressed at early stages of myeloid differentiation of highly purified CD34+ cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132647 stained with Coomassie Blue.

References

ab132647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up