Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRF ERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVW EGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQR EIQLWFQSSELVSWADGGQHSSIHPA
    • Molecular weight

      20 kDa including tags
    • Amino acids

      33 to 187
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The transit peptide is not included. NP_005000.

Specifications

Our Abpromise guarantee covers the use of ab211319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 120 units/mg, and is defined as the amount of enzyme that convert 1.0 umole each of ATP and TDP to ADP and TTP per minute at pH 7.5 at 25°C in a couple system with PK/LDH.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab211319 was purified using conventional chromatography.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • metastatic inhibition factor NM23H4
    • mitochondrial
    • NDK
    • NDKM_HUMAN
    • NDP kinase
    • NDP kinase D
    • NDP kinase, mitochondrial
    • NDPK D
    • NDPKD
    • nm23 H4
    • nm23-H4
    • NM23D
    • NM23H4
    • Nm23M4
    • NME/NM23 nucleoside diphosphate kinase 4
    • NME4
    • Non metastatic cells 4 protein expressed in
    • Non metastatic protein 23, homolog 4
    • Nucleoside diphosphate kinase D
    • Nucleoside diphosphate kinase, mitochondrial
    see all
  • Function

    Major role in the synthesis of nucleoside triphosphates other than ATP.
  • Tissue specificity

    Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
  • Sequence similarities

    Belongs to the NDK family.
  • Cellular localization

    Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab211319 (3µg).   

References

ab211319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up