Description

  • Product name

    Recombinant human Nmnat1/NMNAT protein
    See all Nmnat1/NMNAT proteins and peptides
  • Biological activity

    Specific Activity: ≥4200 pmol/min/µg

    50 μL reaction mixture contained 50 mM Tris-HCl, pH 7.4, 5 mM MgCl2, 0.1 mM NMN, 0.1 mM ATP and various amounts of NMNAT. The reaction was incubated at 37°C for 30 minutes and the amount of ATP consumed was calculated.

  • Purity

    > 95 % SDS-PAGE.
    Lot specific.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVV KGIISPVGD AYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEW KETLKVLRHHQEKLEASDC DHQQNSPTLERPGRKRKWTETQDSSQKKS LEPKTKAVPKVKLLCGADLLESFAVPNL WKSEDITQIVANYGLICVTR AGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRA LRRGQSI RYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      2 to 279
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Nmnat1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Preservative: 1.74% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EC 2.7.7.1
    • LCA9
    • Leber's congenital amaurosis 9
    • NaMN adenylyltransferase 1
    • nicotinamide nucleotide adenylyltransferase 1
    • Nicotinamide-nucleotide adenylyltransferase 1
    • Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
    • nicotinate nucleotide adenylyltransferase 1
    • Nicotinate-nucleotide adenylyltransferase 1
    • NMN adenylyltransferase 1
    • NMN/NaMN adenylyltransferase 1
    • NMNA1_HUMAN
    • Nmnat 1
    • Nmnat1
    • OTTHUMP00000001731
    • OTTHUMP00000001732
    • OTTHUMP00000035892
    • PNAT 1
    • PNAT1
    • pyridine nucleotide adenylyltransferase 1
    see all
  • Function

    Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP (PubMed:17402747). Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency (PubMed:17402747). Can use triazofurin monophosphate (TrMP) as substrate (PubMed:17402747). Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+) (PubMed:17402747). For the pyrophosphorolytic activity, prefers NAD(+) and NaAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively (PubMed:17402747). Involved in the synthesis of ATP in the nucleus, together with PARP1, PARG and NUDT5 (PubMed:27257257). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (PubMed:27257257). Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NaADP(+) (PubMed:17402747). Protects against axonal degeneration following mechanical or toxic insults.
  • Tissue specificity

    Widely expressed with highest levels in skeletal muscle, heart and kidney. Also expressed in the liver pancreas and placenta. Widely expressed throughout the brain.
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; NAD(+) from nicotinamide D-ribonucleotide: step 1/1.
    Cofactor biosynthesis; NAD(+) biosynthesis; deamido-NAD(+) from nicotinate D-ribonucleotide: step 1/1.
  • Involvement in disease

    Leber congenital amaurosis 9
  • Sequence similarities

    Belongs to the eukaryotic NMN adenylyltransferase family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS PAGE analysis of 2 μg ab198473 stained with Coomassie

  • Specific activity of ab198473

References

ab198473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up