Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLK YLGPQQTELFMPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLF SLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLLFEMVCLASVL NVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLH GIQQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVL YLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLF VLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSA ANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCD VGSLGSWVHPLAGNDGPEAQQETDPS
    • Amino acids
      1 to 426
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FM-3
    • G protein-coupled receptor 66
    • G-protein coupled receptor 66
    • G-protein coupled receptor FM-3
    • GPR66
    • Growth hormone secretagogue receptor family Member 3
    • Neuromedin U Receptor 1
    • Neuromedin-U receptor 1
    • NMU-R1
    • NMUR1
    • NMUR1_HUMAN
    see all
  • Function
    Receptor for the neuromedin-U and neuromedin-S neuropeptides.
  • Tissue specificity
    Expressed in greatest abundance in peripheral organs, particularly in elements of the gastrointestinal and urogenital systems with highest levels in testes. In central nervous system structures express levels are much lower than those seen in peripheral organs. Within the CNS, has been detected in highest abundance in the cerebellum, dorsal root ganglia, hippocampus, and spinal cord.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160942 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up