Description

  • Product name

    Recombinant Human NNMT protein
  • Purity

    > 90 % SDS-PAGE.
    ab198647 was expressed in E.coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSG GSHHHHHHGSENLYFQGEFMESGFTSKDTYLSHFNPRDYLEKYYKFGSRH SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEI VVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKL RQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALR NLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYT IEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 264
    • Tags

      His tag N-Terminus
    • Additional sequence information

      cDNA was constructed with codon optimization and expressed with a Human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) fusion at its N-terminal (NP_006160).

Specifications

Our Abpromise guarantee covers the use of ab198647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, Sucrose and DTT.

General Info

  • Alternative names

    • EC 2.1.1.1
    • Nicotinamide N methyltransferase
    • Nicotinamide N-methyltransferase
    • NNMT
    • NNMT_HUMAN
    see all
  • Function

    Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
  • Tissue specificity

    Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
  • Sequence similarities

    Belongs to the NNMT/PNMT/TEMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab198647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up