Description

  • Product name

    Recombinant Human Noelin protein
  • Purity

    > 90 % SDS-PAGE.
    ab156721 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSLPTNPEESWQVYSSAQDSEGRCICTVV APQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQ MKGLESKFKQVEESHKQHLARQFKG
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      34 to 135
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • AMY
    • NEUROBLASTOMA PROTEIN
    • Neuronal olfactomedin-related ER localized protein
    • Noe1
    • NOE1_HUMAN
    • Noel
    • Noel1
    • Noelin
    • Noelin1
    • OlfA
    • Olfactomedin 1
    • Olfactomedin-1
    • Olfm1
    • Pancortin
    • Pancortin 1
    see all
  • Function

    Seems to play an important role in regulating the production of neural crest cells by the neural tube.
  • Sequence similarities

    Contains 1 olfactomedin-like domain.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156721 (3µg).

References

ab156721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up