Overview

  • Product name

    Recombinant Human Nogo Receptor protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      CPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAAS FRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATF HGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRD LGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLG RLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQ KFRGSSSEVPCSLPQRLAGRDLKRLAANDLQGCAVATGPYHPIWTGRATD EEPLGLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDSPPGNGSGP RHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCSRKNRTR SHCRLGQAGSGGGGTGDSEGSVDHHHHHH
    • Molecular weight

      46 kDa including tags
    • Amino acids

      27 to 447

Specifications

Our Abpromise guarantee covers the use of ab153769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab153769 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • NgR
    • Nogo 66 receptor
    • Nogo receptor
    • Nogor
    • Reticulon 4 receptor
    • Rtn4r
    • UNQ330/PRO526
    see all
  • Relevance

    Nogo Receptor mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult central nervous system. It is also a receptor for Nogo A (RTN4), OMG and MAG.
  • Cellular localization

    Cell Membrane

References

ab153769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up