Overview

  • Product name

    Recombinant Human NOL5A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPE ECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSS DLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSS GPEEAVGKSSSKKKKKFHKASQED
    • Molecular weight

      46 kDa including tags
    • Amino acids

      421 to 594

Specifications

Our Abpromise guarantee covers the use of ab132847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as NOL5A

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • NOL5A
    • NOP56
    • NOP56 ribonucleoprotein
    • NOP56 ribonucleoprotein homolog
    • NOP56 ribonucleoprotein homolog (yeast)
    • Nucleolar protein 56
    • Nucleolar protein 5A
    • Nucleolar protein 5A (56kD with KKE/D repeat)
    • Nucleolar protein Nop56
    • RP4-686C3.1
    • SCA36
    see all
  • Relevance

    NOL5A is similar in sequence to Nop56p, a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Like Nop56p, NOL5A is found in the nucleolus and is though to be required for 60S ribosomal subunit biogenesis. Multiple transcript variants encoding several isoforms have been identified for this gene, but the full-length nature of most of them is not yet determined.
  • Cellular localization

    Nuclear; nucleolus

Images

  • 12.5% SDS-PAGE analysis of ab132847 stained with Coomassie Blue.

References

ab132847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up