Description

  • Product name

    Recombinant Human NOLA1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQ IGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYK
    • Amino acids

      60 to 150
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gar1
    • GAR1_HUMAN
    • H/ACA ribonucleoprotein complex subunit 1
    • Nucleolar protein family A member 1
    • nucleolar protein family A member 1 (H/ACA small nucleolar RNPs)
    • snoRNP protein GAR1
    see all
  • Function

    Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
  • Sequence similarities

    Belongs to the GAR1 family.
  • Domain

    Interaction with SMN1 requires at least one of the RGG-box regions.
  • Cellular localization

    Nucleus, nucleolus. Nucleus, Cajal body. Also localized to Cajal bodies (coiled bodies).
  • Information by UniProt

Images

  • ab162737 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162737 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up