Description

  • Product name

    Recombinant human Non Neuronal Enolase protein
  • Biological activity

    Specific activity: > 13 units/ml. One unit will convert 1.0 µmole of 2-phosphoglycerate to phosphoenol pyruvate per minute at pH 7.5 at 25°C.
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
    • Predicted molecular weight

      47 kDa
    • Amino acids

      1 to 434

Specifications

Our Abpromise guarantee covers the use of ab167976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.012% Magnesium sulphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2-phospho-D-glycerate hydro-lyase
    • alpha enolase like 1
    • Alpha-enolase
    • bh3 interacting domain death agonist
    • C-myc promoter-binding protein
    • c-myc promoter-binding protein 1
    • c-myc promoter-binding protein-1
    • eno1
    • ENO1L1
    • ENOA_HUMAN
    • Enolase 1
    • enolase 1 (alpha)
    • HAP 47
    • HAP47
    • MBP-1
    • MPB 1
    • MPB-1
    • MPB1
    • MYC promoter-binding protein 1
    • NNE
    • Non-neural enolase
    • OTTHUMP00000001706
    • Phosphopyruvate hydratase
    • Plasminogen-binding protein
    • PPH
    • tau-crystallin
    see all
  • Function

    Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
    MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
  • Tissue specificity

    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similarities

    Belongs to the enolase family.
  • Developmental stage

    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Nucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line.
  • Information by UniProt

Images

  • 15% SDS PAGE of ab167976 (3µg).

References

This product has been referenced in:

  • Chen FK  et al. Acute progressive paravascular placoid neuroretinopathy with negative-type electroretinography in paraneoplastic retinopathy. Doc Ophthalmol 134:227-235 (2017). Read more (PubMed: 28382556) »
See 1 Publication for this product

Customer reviews and Q&As

Abreviews
Application
Dot blot
used it for serum antibody binding assay. no complaints.

Abcam user community

Verified customer

Submitted Jul 18 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up