Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYL AV
    • Molecular weight
      31 kDa including tags
    • Amino acids
      120 to 171

Specifications

Our Abpromise guarantee covers the use of ab114183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMCBX2
    • CGD
    • CGD91-phox
    • CY24B_HUMAN
    • CYBB
    • Cytochrome b 245, beta polypeptide
    • Cytochrome b(558) beta chain
    • Cytochrome b(558) subunit beta
    • Cytochrome b-245 heavy chain
    • Cytochrome b558 subunit beta
    • GP91 PHOX
    • gp91-1
    • gp91-phox
    • GP91PHOX
    • Heme-binding membrane glycoprotein gp91phox
    • NADPH oxidase 2
    • Neutrophil cytochrome b 91 kDa polypeptide
    • NOX2
    • p22 phagocyte B-cytochrome
    • P91 PHOX
    • p91-PHOX
    • Superoxide-generating NADPH oxidase heavy chain subunit
    see all
  • Function
    Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
  • Involvement in disease
    Defects in CYBB are a cause of chronic granulomatous disease X-linked (XCGD) [MIM:306400]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities
    Contains 1 FAD-binding FR-type domain.
    Contains 1 ferric oxidoreductase domain.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114183 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Vielen Dank für Ihre Anfrage. Gegen die genannten NADPH-Oxidase-Komponenten haben wir folgende Antikörper bzw. Proteine in unserem Katalog: Click here (or use the following: https://www.abcam.com/index.html?datasheet=109366). Click here (or use the following: https://www.abcam.com/index.html?datasheet=80508). Click here (or use the following: https://www.abcam.com/index.html?datasheet=33186). Click here (or use the following: https://www.abcam.com/index.html?datasheet=2244). Click here (or use the following: https://www.abcam.com/index.html?datasheet=118159). Click here (or use the following: https://www.abcam.com/index.html?datasheet=75941). Click here (or use the following: https://www.abcam.com/index.html?datasheet=115855). Click here (or use the following: https://www.abcam.com/index.html?datasheet=59355). Click here (or use the following: https://www.abcam.com/index.html?datasheet=111855). Click here (or use the following: https://www.abcam.com/index.html?datasheet=795). Click here (or use the following: https://www.abcam.com/index.html?datasheet=88031). Click here (or use the following: https://www.abcam.com/index.html?datasheet=98054). Click here (or use the following: https://www.abcam.com/index.html?datasheet=117065). Click here (or use the following: https://www.abcam.com/index.html?datasheet=114183). Click here (or use the following: https://www.abcam.com/index.html?datasheet=84657). Click here (or use the following: https://www.abcam.com/index.html?datasheet=40471). Click here (or use the following: https://www.abcam.com/index.html?datasheet=89246). Click here (or use the following: https://www.abcam.com/index.html?datasheet=82670). Click here (or use the following: https://www.abcam.com/index.html?datasheet=51014). Click here (or use the following: https://www.abcam.com/index.html?datasheet=84655). Click here (or use the following: https://www.abcam.com/index.html?datasheet=78684). Click here (or use the following: https://www.abcam.com/index.html?datasheet=87665). Vielleicht interessiert Sie in diesem Zusammenhang auch einer unserer Assaykits (NADP/NADPH): Click here (or use the following: https://www.abcam.com/index.html?datasheet=65349). Wir geben alle getesteten Spezies und Anwendungen auf unseren Produktdatenblättern an und aktualisieren diese sobald wir neue Informationen erhalten. Falls sich herausstellt, dass der Antikörper nicht so funktioniert, wie auf dem Datenblatt beschrieben und Sie sich innerhalb von sechs Monaten mit Ihrem Problem an uns wenden, werden wir Ihnen gerne Vorschläge zur Optimierung Ihres Protokolls oder gegebenenfalls einen Ersatz oder eine Gutschrift schicken. Falls der Antikörper in einer bisher nicht getesteten Anwendung oder Spezies verwendet wird (z.B. für ab111855 oder ab115855), qualifizieren Sie sich für unser Testprogramm: Bei diesem Angebot bekommen Sie einen 100%igen Rabatt für eine zukünftige Bestellung, wenn Sie uns ein Abreview mit dem Testresultat zusenden. Die Bedingungen zu unserem 100% Abreview Rabatt können Sie unter dem folgenden Link nachlesen: https://www.abcam.com/collaborationdiscount. Falls Sie daran interessiert sind oder weitere Fragen haben, kontaktieren Sie bitte unseren wissenschaftlichen Dienst. Die oben genannten Antikörper sind nur eine Auswahl und wir haben noch weitere gegen die entsprechenden Zielproteine erhältlich, die für unterschiedliche Anwendungen getestet und garantiert sind. Bei einer detaillierteren Suche bzw. Beratung bin ich Ihnen gerne weiter behilflich. Gerne senden wir Ihnen auch gerne ein Angebot zu, sobald Sie eine konkrete Auswahl getroffen haben. Ich hoffe, diese Informationen helfen Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up