Overview

  • Product name

    Recombinant Human Noxa protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLS SSLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTL LLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 136

Specifications

Our Abpromise guarantee covers the use of ab152618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adult T cell leukemia derived PMA responsive
    • APR
    • APR_HUMAN
    • ATL-derived
    • Immediate early response protein APR
    • Immediate-early-response protein APR
    • NOXA
    • Phorbol 12 myristate 13 acetate induced protein 1
    • Phorbol-12-myristate-13-acetate-induced protein 1
    • PMA induced protein 1
    • PMA-induced protein 1
    • PMA-responsive gene
    • Pmaip1
    • Protein Noxa
    see all
  • Function

    Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
  • Tissue specificity

    Highly expressed in adult T-cell leukemia cell line.
  • Sequence similarities

    Belongs to the PMAIP1 family.
  • Domain

    The BH3 motif is essential for pro-apoptotic activity.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152618 stained with Coomassie Blue.

References

ab152618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up