Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSE VSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
    • Amino acids

      646 to 738
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Basic helix loop helix PAS protein MOP4
    • Basic-helix-loop-helix-PAS protein MOP4
    • bHLHe9
    • class E basic helix loop helix protein 9
    • Class E basic helix-loop-helix protein 9
    • FLJ23138
    • Member of PAS protein 4
    • Member of PAS superfamily 4
    • MGC71151
    • MOP4
    • Neuronal PAS domain containing protein 2
    • Neuronal PAS domain protein 2
    • Neuronal PAS domain-containing protein 2
    • Neuronal PAS2
    • NPAS2
    • NPAS2_HUMAN
    • PAS domain containing protein 4
    • PAS domain-containing protein 4
    • PASD4
    see all
  • Function

    BMAL1-NPAS2 heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins of the circadian clock. This transcription is inhibited in a feedback loop by PER, and also by CRY proteins.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159010 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up