Overview

  • Product name
    Recombinant Human NPEPPS protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVK AFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV
    • Amino acids
      776 to 875
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAP-S
    • Aminopeptidase puromycin sensitive
    • Cytosol alanyl aminopeptidase
    • Metalloprotease 100
    • Metalloprotease MP100
    • MP 100
    • MP100
    • Npepps
    • Psa
    • PSA_HUMAN
    • Puromycin sensitive aminopeptidase
    • Puromycin-sensitive aminopeptidase
    see all
  • Function
    Aminopeptidase with broad substrate specificity for several peptides. Involved in proteolytic events essential for cell growth and viability. May act as regulator of neuropeptide activity. Plays a role in the antigen-processing pathway for MHC class I molecules. Involved in the N-terminal trimming of cytotoxic T-cell epitope precursors. Digests the poly-Q peptides found in many cellular proteins. Digests tau from normal brain more efficiently than tau from Alzheimer disease brain.
  • Tissue specificity
    Detected in liver, epithelium of renal tubules, epithelium of small and large intestine, gastric epithelial cells, and alveoli of the lung (at protein level).
  • Sequence similarities
    Belongs to the peptidase M1 family.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus.
  • Information by UniProt

Images

  • ab160527 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up