Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGR AGTPGEPRAPAATVVDVDEVRGSGEEGTEVVALLESERPEEGTKSSGLGA CEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLGHLLPGRAKGP GLFFFLPCLDTYHKVDLRLQTLEIPFHEVALDSVTCIWGIKVERIEIKDV RLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAA VQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSK PVEPLNPKKKDSPML
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 315

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • nephrosis 2, idiopathic, steroid resistant
    • Nephrosis 2, idiopathic, steroid resistant (podocin)
    • NPHS2
    • NPHS2 gene
    • PDCN
    • PODO_HUMAN
    • Podocin
    • SRN1
    see all
  • Function

    Plays a role in the regulation of glomerular permeability, acting probably as a linker between the plasma membrane and the cytoskeleton.
  • Tissue specificity

    Almost exclusively expressed in the podocytes of fetal and mature kidney glomeruli.
  • Involvement in disease

    Defects in NPHS2 are the cause of nephrotic syndrome type 2 (NPHS2) [MIM:600995]. It is a renal disorder characterized clinically by childhood onset of proteinuria, hypoalbuminemia, hyperlipidemia, and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. The disorder is resistant to steroid treatment and progresses to end-stage renal failure in the first or second decades. Some patients show later onset of the disorder.
  • Sequence similarities

    Belongs to the band 7/mec-2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152821 stained with Coomassie Blue.

References

ab152821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up