Overview

  • Product name

    Recombinant Human NPP-7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRGPAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVD TPNLDAMARDGVKARYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMYYN TTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSFFYPGGNVTYQ GVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDS TGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMT TVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDAL KDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNN GEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPE ANDGHLATLLPMLHTESALPPDGRPTLLPKGRSALPPSSRPLLVMGLLGT VILLSEVA
    • Amino acids

      1 to 458
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ALK SMase
    • Alk-SMase
    • Alkaline sphingomyelin phosphodiesterase
    • E-NPP 7
    • Ectonucleotide pyrophosphatase/phosphodiesterase 7
    • Ectonucleotide pyrophosphatase/phosphodiesterase family member 7
    • ENPP7
    • ENPP7_HUMAN
    • Intestinal alkaline sphingomyelinase
    • NPP-7
    see all
  • Function

    Converts sphingomyelin to ceramide. Also has phospholipase C activity toward palmitoyl lyso-phosphocholine. Does not appear to have nucleotide pyrophosphatase activity.
  • Tissue specificity

    Detected in the colon (at protein level). Expressed in the duodenum, jejunum and liver and at low levels in the ileum. Expression was very low in the esophagus, stomach and colon.
  • Sequence similarities

    Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
  • Post-translational
    modifications

    N-glycosylated; required for activity and transport to the plasma membrane.
  • Cellular localization

    Membrane. Localized at the surface of the microvillar membrane in small intestine enterocytes, and in endosome-like structures situated beneath the microvillar membrane, and in Golgi complex.
  • Information by UniProt

Images

  • ab166261 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up