Description

  • Product name

    Recombinant Human NPR-C protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRR LLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      42 to 140

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as Natriuretic Peptide Receptor C

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ANP C
    • ANP-C
    • ANPC
    • ANPR-C
    • ANPRC
    • ANPRC_HUMAN
    • Atrial natriuretic peptide C type receptor
    • Atrial natriuretic peptide clearance receptor
    • Atrial natriuretic peptide receptor 3
    • Atrial natriuretic peptide receptor type C
    • Atrionatriuretic peptide receptor C
    • C5orf23
    • FLJ14054
    • GUCY2B
    • MGC22189
    • Natriuretic peptide receptor C/guanylate cyclase C
    • Natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)
    • NPR 3
    • NPR C
    • NPR-C
    • Npr3
    • NPRC
    see all
  • Function

    Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyclase activity.
  • Sequence similarities

    Belongs to the ANF receptor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab114355 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up