Overview

  • Product name

    Recombinant Human NPRL2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSGCRIECIFFSEFHLTLGPKITYQVPEDFISRELFDTVQVYIITKPEP QNKLITVTAMEKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEP IVKKLAGYLTTLELESSFVSMEESKQKLVPIMTILLEELNASGRCTLPID ESNTIHLKVIEQRPDPPVAQEYDVPVFTKDKEDFFNSQWDLTTQQILPYI DGFRHIQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQYSNVYCPTPK VQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGR HPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHS YDEICCKTGMSYHELDERLENDPNIIICWK
    • Molecular weight

      68 kDa including tags
    • Amino acids

      1 to 380

Specifications

Our Abpromise guarantee covers the use of ab131926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

    Previously labelled as NPR2L. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2810446G01Rik
    • G21 protein
    • Gene 21 protein
    • Homologous to yeast nitrogen permease
    • Homologous to yeast nitrogen permease (candidate tumor suppressor)
    • Nitrogen permease regulator 2-like protein
    • Nitrogen permease regulator-like 2 (S. cerevisiae)
    • NPR 2L
    • NPR L2
    • NPR like 2
    • NPR2
    • NPR2 like
    • NPR2-like protein
    • NPR2L
    • NPRL 2
    • NPRL2
    • NPRL2_HUMAN
    • Tumor suppressor candidate 4
    • TUSC 4
    • TUSC 4 protein
    • TUSC4
    • TUSC4 protein
    see all
  • Function

    Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs.
  • Tissue specificity

    Most abundant in skeletal muscle, followed by brain, liver and pancreas, with lower amounts in lung, kidney, placenta and heart. Expressed in most lung cancer cell lines tested.
  • Sequence similarities

    Belongs to the NPR2 family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131926 stained with Coomassie Blue.

References

ab131926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up