Overview

  • Product name

    Recombinant Human NPY5R protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTF VSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLT SVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNN LTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVE SWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLE ENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHEL RVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISN RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM
    • Molecular weight

      75 kDa including tags
    • Amino acids

      1 to 445

Specifications

Our Abpromise guarantee covers the use of ab132113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

    Previously labelled as NPY5R. 

     This product was previously labelled as Y5 receptor

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Neuropeptide Y receptor type 5
    • Neuropeptide Y receptor Y5
    • NPY 5R
    • NPY R5
    • NPY Y5
    • NPY Y5 receptor
    • NPY-Y5 receptor
    • NPY5 R
    • NPY5-R
    • NPY5R
    • NPY5R_HUMAN
    • NPYR 5
    • NPYR5
    • NPYY 5
    • NPYY5
    • NPYY5-R
    • Y5 receptor
    see all
  • Function

    Receptor for neuropeptide Y and peptide YY. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Seems to be associated with food intake. Could be involved in feeding disorders.
  • Tissue specificity

    Brain; hypothalamus.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132113, stained with Coomassie Blue.

References

ab132113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up